The short version of gastric juice protein fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-10-09. Anything still debated is marked as such rather than presented as settled.
Within the research literature, the peptide is discussed through several provisional mechanisms, including cytoprotection, modulation of growth factor signaling, and interaction with the nitric oxide system. None of these mechanisms is fully characterized, and no single pathway is universally accepted. Review articles typically note the gap between consistent animal findings and sparse human evidence. The compound is classified as a research chemical rather than an approved pharmaceutical, which shapes how studies are designed, funded, and reported.
BPC-157 is a synthetic pentadecapeptide with the sequence GEPPPGKPADDAGLV, corresponding to a partial fragment of a larger protein detected in human gastric juice. The name derives from the parent protein designation BPC, an abbreviation of body protection compound, with 157 acting as a fraction or batch identifier used by the original investigators. Its molecular weight is approximately 1419 daltons, and the chain contains no unusual residues or disulfide bridges. In the literature it is described as a short, water-soluble fragment rather than a complete natural protein.
Most early work on this peptide originated in the 1990s from a research group in Zagreb, Croatia, relying on animal models and cell cultures. Reported observations included effects on gastrointestinal lesion healing, tendon fibroblast migration, and blood vessel formation under controlled laboratory conditions. These findings come predominantly from rodent studies and in vitro assays rather than from human trials. Controlled human data remain limited, and the degree to which animal results translate to human physiology is an open question rather than a settled fact.
Most published findings come from rodent models, where the peptide has been examined in wound-healing, gastrointestinal-lesion, tendon, and vascular-injury preparations. A smaller number of early human studies have been reported, chiefly in inflammatory bowel conditions, but the public record is short and has not led to marketing approval in the United States or the European Union. Reviewers therefore classify the compound as investigational, and whether animal results carry over to people remains an open question rather than a settled one.
Outside laboratory supply channels, the peptide is sold as a research chemical, a category that carries no requirement to demonstrate purity, identity, or freedom from contamination. Because it is not an approved medicine, products labeled BPC-157 sit in a regulatory gap in many countries, and actual content may differ from the label. Sports organizations list it among prohibited substances, so its presence in an athlete's sample can produce a doping finding regardless of how the material was obtained.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C62H98N16O22 | computed for the free peptide |
| Molecular weight | about 1419 Da | monoisotopic mass near 1418.7 |
| Amino acid count | 15 | single chain, no disulfide bonds |
| Solubility | freely soluble in water | also dissolves in saline and phosphate buffer |
| Common synonyms | pentadecapeptide BPC, BPC 157 | fragment notation varies by source |
Handling practice centers on limiting moisture, heat, and mechanical stress. Powder is typically allowed to reach room temperature before opening so that condensation does not form on the contents, and solutions are prepared with sterile or low-particulate water. Peptides can adsorb to certain plastics and membrane filters, so container and filter material is sometimes specified to reduce losses at low concentrations. Working aliquots are usually frozen separately rather than sampled repeatedly from one stock. Recording lot number, preparation date, and storage conditions supports later comparison between experiments.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, which separates the target peptide from truncated sequences and other synthesis by-products. Mass spectrometry, typically electrospray ionization coupled to liquid chromatography, confirms the expected mass and helps detect modifications. Amino acid analysis can verify composition when residue-level confirmation is needed. Because common impurities differ from the target by only one or two residues, chromatographic resolution often matters more than a single headline purity percentage. Impurity profiles are most informative when compared against a validated reference standard.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry using electrospray or MALDI ionisation. Amino acid analysis and peptide mapping by enzymatic digestion provide additional sequence-level confirmation. Purity is commonly reported as an area percentage from a chromatographic trace, and water content can be measured by Karl Fischer titration. Reported masses may differ by tens of daltons between sources because preparations can contain acetate or trifluoroacetate counterions, and such differences are not by themselves evidence of a different peptide.
BPC-157 is normally distributed as a lyophilised powder that ranges from white to off-white in appearance. The peptide dissolves readily in water, normal saline, and common aqueous buffers, and it is poorly soluble in nonpolar solvents such as hexane or vegetable oils. Lyophilised vials take up moisture if left open, which changes the mass of powder in the container and complicates any later weighing. Because the material is handled in small quantities, static and adhesion to glass or plastic can also cause noticeable losses during transfer.
Treatment of depression: Used in adults who may present with symptoms of anxiety, low mood, lack of enthusiasm, and restlessness. Treatment of anxiety: Indicated for patients with anxiety disorders, especially when depression is also present or when there is associated asthenia (unexplained fatigue or weakness). Management of asthenia: Used for conditions characterized by fatigue, low energy, and diminished motivation, frequently seen with mood disturbances. Psychosomatic and neurotic disorders: Recommended for depressive neuroses, psychogenic depression, masked depression, neurasthenia, and psychosomatic affections where anxiety, depression, or apathy are prominent. Menopausal depression: Often indicated for mood changes associated with menopause. Depression in alcoholics and drug addicts: Used in cases where mood disorders accompany substance dependence.
=== Silage === Lactiplantibacillus plantarum is the most common bacterium used in silage inoculants. During the anaerobic conditions of ensilage, these organisms quickly dominate the microbial population, and, within 48 hours, they begin to produce lactic and acetic acids via the Embden-Meyerhof Pathway, further diminishing their competition. Under these conditions, L. plantarum strains producing high levels of heterologous proteins have been found to remain highly competitive. This quality could allow this species to be utilized as an effective biological pretreatment for lignocellulosic biomass.
Very few of our contributors believe that a "definitive" history of the Cold War is possible (or indeed that it should be possible). But a heterogeneous approach creates a strong need for contextualization. ... First and foremost we need to situate the Cold War within the wider history of the twentieth century in a global perspective. We need to indicate how Cold War conflicts connect to broader trends in social, economic, and intellectual history as well as to the political and military developments of the longer term of which it forms a part. Corresponding to the broader "emotional turn" in 21st century historiography, historians have increasingly begun to consider the unfolding of the Cold War in emotional and psychological terms. They have sought emotional explanations for political decisions and developments typically examined from a rational perspective and have analysed interpersonal dynamics between world leaders. Frank Costigliola is a prolific proponent of the role of emotion in historical analysis. For example, he positions the breakdown of the wartime alliance between the United States and the Soviet Union and the hostilities of the early Cold War as being, in part, a result of the heightened emotions of key figures in American foreign policy, like Averell Harriman, following the death of Franklin D. Roosevelt. To Costigliola, it was the "attitudes and rhetoric" of key diplomats at the end of World War II that set the tone for future relations between the United States and the Soviet Union.
== Biochemistry == Ricin is classified as a type 2 ribosome-inactivating protein (RIP)[N.B]. Whereas type 1 RIPs are composed of a single protein chain that possesses catalytic activity, type 2 RIPs, also known as holotoxins, are composed of two different protein chains that form a heterodimeric complex. Type 2 RIPs consist of an A chain that is functionally equivalent to a type 1 RIP, covalently connected by a single disulfide bond to a B chain that is catalytically inactive, but serves to mediate transport of the A-B protein complex from the cell surface, via vesicle carriers, to the lumen of the endoplasmic reticulum (ER). Both type 1 and type 2 RIPs are functionally active against ribosomes in vitro; however, only type 2 RIPs display cytotoxicity due to the lectin-like properties of the B chain. To display its ribosome-inactivating function, the ricin disulfide bond must be reductively cleaved.
Sources: en.wikipedia.org
Someone with a good memory of the conversation once told me how Lord Carrington, then one of the "mediators" of the incipient post-Yugoslavia war, came to the conclusion that Slobodan Milosevic was a highly dangerous man. Well-disposed toward Serbia (as the British establishment has always been), Carrington told the late dictator that he understood Serb concerns about significant Serbian minorities in Bosnia and Croatia. But why did Milosevic also insist on exclusive control over Kosovo, where the Albanian population was approximately 90 percent? "That," replied Milosevic coldly, "is for historical reasons." It's a shame, in retrospect, that it took us so long to diagnose the pathology of Serbia's combination of arrogance and self-pity, in which what is theirs is theirs and what is anybody else's is negotiable. After the war, Hitchens supported Kosovo's independence and criticized the burning of the US Embassy in Belgrade as a response to it:
=== SOMC LIFE Center === The LIFE Center provides full service fitness and rehabilitation facilities in Scioto County through centers in Portsmouth, Wheelersburg and Lucasville. Additionally, SOMC has hosted events designed to promote fitness and physical activity, such as the ‘Tri For Your LIFE’ sprint triathlon and ‘Run for your LIFE’ 5/10k. In its first year, SOMC's ‘Tri For Your LIFE’ triathlon featured more than 100 competitors.
The album fused together the Reids' two primary influences: the guitar noise of the Stooges and the Velvet Underground with the pop songwriting and melodies of the Beach Boys, The Shangri-Las and Phil Spector; In fact, the album's opening song, "Just Like Honey," borrows Hal Blaine's famous drum intro from The Ronettes 1963 classic, "Be My Baby", produced and co-written by Spector. The record received unanimously positive reviews and is now considered a landmark recording. Drummer Gillespie announced his departure from the band in October 1985, to concentrate on Primal Scream. He had recorded most of the drums on Psychocandy, with John Moore filling in when Gillespie was unavailable, eventually joining the band to replace him. John Loder also acted as a stand-in drummer when Gillespie was unavailable for live performances. When the band signed to Blanco y Negro in January 1985, there were stories reporting that they had stolen money from managing Director Rob Dickens's jacket and destroyed his office, all untrue but seen as good publicity by manager McGee. In a performance on Belgian television in March 1985, the band did smash the set and the audio equipment, but this was at the request of the TV producer. Such behaviour became expected of the band and many shows culminated with the Reids trashing their equipment, which was often followed by the audience throwing projectiles onto the stage and damaging equipment. On 15 March 1985, the Jesus and Mary Chain played a gig at the North London Polytechnic in front of one of their largest crowds up to that point.
== In degradation of drug delivery systems == Among various types of cancer, lung cancer, larynx cancer, mouth cancer, and breast cancer exhibit higher concentrations (10-40 mM) of GSH compared to healthy cells. Thus, drug delivery systems containing disulfide bonds, typically cross-linked micro-nanogels, stand out for their ability to degrade in the presence of high concentrations of glutathione (GSH). This degradation process releases the drug payload specifically into cancerous or tumorous tissue, leveraging the significant difference in redox potential between the oxidizing extracellular environment and the reducing intracellular cytosol. When internalized by endocytosis, nanogels encounter high concentrations of GSH inside the cancer cell. GSH, a potent reducing agent, donates electrons to disulfide bonds in the nanogels, initiating a thiol-disulfide exchange reaction. This reaction breaks the disulfide bonds, converting them into two thiol groups, and facilitates targeted drug release where it is needed most. This reaction is called a thiol-disulfide exchange reaction.
To reduce the tightness and dehydration of the skin, Lubricant ointment has been used. When the skin becomes less tense, it doesn't pull at the lips as much causing a reduction in the eclabium. Once the skin is loose enough the eclabium subsides. Eclabium can be a lifelong disorder, but drug treatment for the causing disease would heal the lips as well. For example for harlequin ichthyosis drugs such as Tazarotene and isotretinoin have been used to help the skin heal and loosen up which helps the eclabium heal. But sometimes surgery might become necessary to correct the disorder. Lateral columella base-labrum transposition flap results in soft linear scars without hyperplasia. It is an easy, minimally invasive and nearly no secondary malformation method. a type of flap used is the Limberg/Rhomboid flap. The flap is made up of Cutaneous tissue to close defects anywhere on the body. If the eclabium is caused by periodontitis, treatment includes removal of plaque and calculus from the teeth, antimicrobial mouth rinse such as chlorhexidine, antiseptic chips/gels. When the swelling in the gums reduces it will no longer push on lips making them turn outwards.
Sources: en.wikipedia.org
=== Controversy and plasticity === In spite of a burgeoning literature supporting TPCs as the NAADP-regulated channel, this was challenged in 2012/13 by reports that TPCs are, instead, Na+ channels regulated by the endo-lysosomal lipid, Phosphatidylinositol 3,5-bisphosphate, PI(3,5)P2 and also by metabolic state (via ATP and mTOR). This controversy ultimately evolved into a new model of how TPCs work. The challenge raised two different, but interrelated issues: (a) TPCs are insensitive to NAADP; (b) TPCs are Na+- (and not Ca2+-) permeable.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
== Chemistry literature == Scientific literature Scientific journal Academic journal List of important publications in chemistry List of scientific journals in chemistry List of science magazines Scientific American
To reinforce his intentions for the Smithsonian, Henry established laboratories, developed a robust physical sciences library, and started the Smithsonian Contributions to Knowledge, the first of many publications intended to disseminate research results. For Henry, the Library of Congress was the obvious choice as the national library. Unable to resolve the conflict, Henry dismissed Jewett in July 1854. In 1865, the Smithsonian building, also called the Castle due to its Norman architectural style, was severely damaged by fire. This incident presented Henry with an opportunity related to the Smithsonian's non-scientific library. Around this time, the Library of Congress was planning to build and relocate to the new Thomas Jefferson Building, designed to be fireproof. Authorized by an act of Congress, Henry transferred the Smithsonian's non-scientific library of 40,000 volumes to the Library of Congress in 1866. In 1861, President Abraham Lincoln appointed John G. Stephenson as Librarian of Congress; the appointment is regarded as the most political to date. Stephenson was a physician and spent equal time serving as librarian and as a physician in the Union Army. He could manage this division of interest because he hired Ainsworth Rand Spofford as his assistant. Despite his new job, Stephenson focused on the war. Three weeks into his term as Librarian of Congress, he left Washington, D.C., to serve as a volunteer aide-de-camp at the battles of Chancellorsville and Gettysburg during the American Civil War.
== Functions in animals == Selenium is an essential micronutrient in mammals, but is also recognized as toxic in excess. Selenium exerts its biological functions through selenoproteins, which contain the amino acid selenocysteine. Twenty-five selenoproteins are encoded in the human genome.
Sources: en.wikipedia.org
The sequence corresponds to a fragment of a protein found in human gastric juice, so related sequences are natural. The isolated fifteen-amino-acid peptide supplied for research is produced synthetically. Whether the free fragment circulates naturally in humans has not been settled.
In most jurisdictions it is not an approved medicine and is handled as a research material. Import and sale rules differ by country, and some regulators have placed it in categories that restrict human use. Status can change, so current local rules apply.
Rodent models dominate, particularly rats with induced gastric lesions, tendon injury, or vascular disruption. These designs allow controlled comparison but differ anatomically and metabolically from humans. Results from such models are commonly cited as preliminary.
It is not approved for human use in the United States or the European Union. Clinical material has been studied in a small number of early trials, mainly for inflammatory bowel conditions, and the compound remains investigational. Regulators treat marketed products as unapproved rather than as authorized drugs.